목록Bioinformatics/Linux (5)

A Fine-Tuned Universe

ls 모든 옵션 (man ls)

LS(1) User Commands LS(1) NAME ls - list directory contents SYNOPSIS ls [OPTION]... [FILE]... DESCRIPTION List information about the FILEs (the current directory by default). Sort entries alphabetically if none of -cftuvSUX nor --sort is specified. Mandatory arguments to long options are mandatory for short options too. -a, --all do not ignore entries starting with . -A, --almost-all do not list..
Bioinformatics/Linux 2023. 7. 3. 18:41
디렉토리 내의 모든 fasta 파일로부터 header에 16S를 포함하는 시퀀스만 추출하기

#!/bin/bash search_string="16S" for file in ./*.fna; do while IFS= read -r line; do if [[ "$line" == *"$search_string"* ]]; then echo "$line" >> "$file.filtered" while IFS= read -r inner_line; do if [[ "$inner_line" == ">"* ]]; then break else echo "$inner_line" >> "$file.filtered" fi done fi done < "$file" done awk, sed 같은 걸 써야할 것 같았는데... 엄청 간단했다
Bioinformatics/Linux 2023. 6. 29. 15:46
[FastANI] 한 줄씩 출력되는 FastANI 결과를 matrix로 변환하기

FastANI 결과를 보면 아래와 같이 나온다 즉 genome1 genome2 ANI값 이런 식으로 나온다 하지만 보통은 matrix 형태로 정리된 아래 형태에 익숙할 것이다. 아니면 아래와 같은 형식으로 바꿔서 결과를 정리해야 할 때가 있다 그런데 비교하려는 유전체가 많아질 수록 결과를 정리하기가 힘들다. 그래서 주말에 아래와 같이 쉘스크립트를 써서 결과를 정리하였다 먼저 유전체 목록을 아래와 같이 파일로 만들었다. 사실 둘 다 같은 내용인데 가로 세로를 구분해서 생각하려고 따로 만들었다 ls *.gz > query_list ls *.gz > reference_list 그리고 아래와 같이 스크립트를 짜서 실행시켰다. #!/bin/bash while read query do awk -v genome=$q..
Bioinformatics/Linux 2023. 6. 27. 18:11
gff 파일에서 locus tag과 product만 추출하기

NCBI GenBank에서 유전체 정보를 보면 자주 참고하는 자료가 있고 계속 반복되어 나오지만 실제로는 보지 않는 자료가 있다 gbk 형식은 아래와 같이 생겼는데 gene complement(1616..1951) /locus_tag="MAE_00030" CDS complement(1616..1951) /locus_tag="MAE_00030" /codon_start=1 /transl_table=11 /product="ferredoxin" /protein_id="BAF99824.1" /translation="MPRITVYGQTITCDRGENLRRILLKHDISLYNGASKLINCRGIG SCGTCAVAIVGEVSAINWQEKARLSLPPHNPDNNRRLACQVKVFGDIEVTKYDGFWGQ GDSVISDQ..
Bioinformatics/Linux 2023. 1. 27. 11:00
이전 Prev 1 2 Next 다음